Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 653650..654299 | Replicon | chromosome |
| Accession | NZ_CP109727 | ||
| Organism | Enterobacter roggenkampii strain 2017-45-51-04-01 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OI980_RS03095 | Protein ID | WP_045352827.1 |
| Coordinates | 653946..654299 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1H8WUL1 |
| Locus tag | OI980_RS03090 | Protein ID | WP_045352829.1 |
| Coordinates | 653650..653949 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI980_RS03060 (OI980_03060) | 649052..650011 | - | 960 | WP_032675710.1 | DUF523 and DUF1722 domain-containing protein | - |
| OI980_RS03065 (OI980_03065) | 650114..650524 | - | 411 | WP_008500117.1 | hydroxyisourate hydrolase | - |
| OI980_RS03070 (OI980_03070) | 650624..651349 | - | 726 | WP_008500116.1 | MerR family transcriptional regulator | - |
| OI980_RS03075 (OI980_03075) | 651467..651991 | + | 525 | WP_008500115.1 | lipocalin family protein | - |
| OI980_RS03080 (OI980_03080) | 652070..653116 | + | 1047 | WP_045352831.1 | class I SAM-dependent methyltransferase | - |
| OI980_RS03085 (OI980_03085) | 653183..653620 | + | 438 | WP_045352830.1 | acetyltransferase | - |
| OI980_RS03090 (OI980_03090) | 653650..653949 | - | 300 | WP_045352829.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OI980_RS03095 (OI980_03095) | 653946..654299 | - | 354 | WP_045352827.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OI980_RS03100 (OI980_03100) | 654730..655071 | - | 342 | WP_045352825.1 | SymE family type I addiction module toxin | - |
| OI980_RS03105 (OI980_03105) | 655155..655352 | + | 198 | WP_045352823.1 | toxin-antitoxin system HicB family antitoxin | - |
| OI980_RS03110 (OI980_03110) | 655365..656222 | - | 858 | WP_045352822.1 | WYL domain-containing protein | - |
| OI980_RS03115 (OI980_03115) | 656402..656572 | + | 171 | WP_164725120.1 | hypothetical protein | - |
| OI980_RS03120 (OI980_03120) | 657069..657881 | - | 813 | WP_045352820.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13508.45 Da Isoelectric Point: 8.8479
>T262015 WP_045352827.1 NZ_CP109727:c654299-653946 [Enterobacter roggenkampii]
VDGSVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFDPVRQA
IVLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
VDGSVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFDPVRQA
IVLCAGDKSNDKTFYEKMIRIADAEFSLHLTSQEAAK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|