Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3152597..3153254 | Replicon | chromosome |
| Accession | NZ_CP109694 | ||
| Organism | Enterobacter asburiae strain 2017-45-54-05 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A808IF03 |
| Locus tag | OI909_RS15420 | Protein ID | WP_033146338.1 |
| Coordinates | 3152597..3152896 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A808ICP3 |
| Locus tag | OI909_RS15425 | Protein ID | WP_033146339.1 |
| Coordinates | 3152907..3153254 (+) | Length | 116 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI909_RS15410 (OI909_15405) | 3148967..3151165 | + | 2199 | WP_284592831.1 | type I secretion system permease/ATPase | - |
| OI909_RS15415 (OI909_15410) | 3151176..3152345 | + | 1170 | WP_086374946.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| OI909_RS15420 (OI909_15415) | 3152597..3152896 | + | 300 | WP_033146338.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OI909_RS15425 (OI909_15420) | 3152907..3153254 | + | 348 | WP_033146339.1 | HigA family addiction module antitoxin | Antitoxin |
| OI909_RS15430 (OI909_15425) | 3153299..3153724 | + | 426 | WP_033146340.1 | nucleoside triphosphatase NudI | - |
| OI909_RS15435 (OI909_15430) | 3153696..3154427 | - | 732 | WP_207167826.1 | helix-turn-helix transcriptional regulator | - |
| OI909_RS15440 (OI909_15435) | 3154525..3154944 | + | 420 | WP_182072763.1 | nuclear transport factor 2 family protein | - |
| OI909_RS15445 (OI909_15440) | 3154947..3155465 | - | 519 | WP_182072765.1 | hypothetical protein | - |
| OI909_RS15450 (OI909_15445) | 3155550..3156730 | - | 1181 | Protein_3036 | PLP-dependent aminotransferase family protein | - |
| OI909_RS15455 (OI909_15450) | 3156751..3157638 | - | 888 | WP_182072767.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11691.32 Da Isoelectric Point: 10.0346
>T262005 WP_033146338.1 NZ_CP109694:3152597-3152896 [Enterobacter asburiae]
MISYFRDQWLEDFFLYGRSSNVIPANLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGKAEDLYLSPHKYTQHK
MISYFRDQWLEDFFLYGRSSNVIPANLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGKAEDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808IF03 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808ICP3 |