Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2460686..2461346 | Replicon | chromosome |
| Accession | NZ_CP109694 | ||
| Organism | Enterobacter asburiae strain 2017-45-54-05 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A808IFD9 |
| Locus tag | OI909_RS12150 | Protein ID | WP_048980127.1 |
| Coordinates | 2460993..2461346 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1Z3MX79 |
| Locus tag | OI909_RS12145 | Protein ID | WP_029741460.1 |
| Coordinates | 2460686..2460988 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI909_RS12115 (OI909_12110) | 2455793..2457982 | + | 2190 | WP_047061141.1 | TonB-dependent siderophore receptor | - |
| OI909_RS12125 (OI909_12120) | 2458277..2458609 | - | 333 | WP_058841450.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| OI909_RS12130 (OI909_12125) | 2458610..2458867 | - | 258 | WP_058841451.1 | hypothetical protein | - |
| OI909_RS12135 (OI909_12130) | 2459159..2459548 | - | 390 | WP_096150847.1 | RidA family protein | - |
| OI909_RS12140 (OI909_12135) | 2459690..2460610 | + | 921 | WP_048980124.1 | LysR family transcriptional regulator | - |
| OI909_RS12145 (OI909_12140) | 2460686..2460988 | - | 303 | WP_029741460.1 | XRE family transcriptional regulator | Antitoxin |
| OI909_RS12150 (OI909_12145) | 2460993..2461346 | - | 354 | WP_048980127.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OI909_RS12155 (OI909_12150) | 2461524..2462417 | - | 894 | WP_048980130.1 | LysR substrate-binding domain-containing protein | - |
| OI909_RS12165 (OI909_12160) | 2463927..2464532 | + | 606 | WP_048980132.1 | glutathione S-transferase family protein | - |
| OI909_RS12170 (OI909_12165) | 2464576..2465526 | - | 951 | WP_023336219.1 | HTH-type transcriptional regulator Cbl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2458610..2474391 | 15781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13599.44 Da Isoelectric Point: 8.9620
>T262004 WP_048980127.1 NZ_CP109694:c2461346-2460993 [Enterobacter asburiae]
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRYSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREFTHWLDRLKERE
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRYSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREFTHWLDRLKERE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808IFD9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Z3MX79 |