Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4392442..4393102 | Replicon | chromosome |
Accession | NZ_CP109692 | ||
Organism | Enterobacter asburiae strain 2017-45-80 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OI907_RS21590 | Protein ID | WP_033145931.1 |
Coordinates | 4392442..4392795 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1Z3MX79 |
Locus tag | OI907_RS21595 | Protein ID | WP_029741460.1 |
Coordinates | 4392800..4393102 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI907_RS21570 (OI907_21550) | 4388584..4389501 | + | 918 | WP_033145933.1 | nitrogen assimilation transcriptional regulator NAC | - |
OI907_RS21575 (OI907_21555) | 4389598..4390548 | + | 951 | WP_023336219.1 | HTH-type transcriptional regulator Cbl | - |
OI907_RS21580 (OI907_21560) | 4390592..4391200 | - | 609 | WP_080277780.1 | glutathione S-transferase family protein | - |
OI907_RS21585 (OI907_21565) | 4391371..4392264 | + | 894 | WP_033145932.1 | LysR substrate-binding domain-containing protein | - |
OI907_RS21590 (OI907_21570) | 4392442..4392795 | + | 354 | WP_033145931.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OI907_RS21595 (OI907_21575) | 4392800..4393102 | + | 303 | WP_029741460.1 | XRE family transcriptional regulator | Antitoxin |
OI907_RS21600 (OI907_21580) | 4393178..4394098 | - | 921 | WP_033145930.1 | LysR family transcriptional regulator | - |
OI907_RS21605 (OI907_21585) | 4394240..4394629 | + | 390 | WP_033145929.1 | RidA family protein | - |
OI907_RS21610 (OI907_21590) | 4394921..4395178 | + | 258 | WP_033145928.1 | antitoxin | - |
OI907_RS21615 (OI907_21595) | 4395179..4395511 | + | 333 | WP_033145927.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
OI907_RS21620 (OI907_21600) | 4395468..4395662 | - | 195 | WP_080277779.1 | hypothetical protein | - |
OI907_RS21625 (OI907_21605) | 4395832..4397193 | - | 1362 | WP_003036316.1 | HEPN/Toprim-associated domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4383912..4412537 | 28625 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13577.40 Da Isoelectric Point: 8.0361
>T261989 WP_033145931.1 NZ_CP109692:4392442-4392795 [Enterobacter asburiae]
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
MLCAGNKVGNERRFYDEMLLVADQEFTHWLDRLKERE
VWAINTTDRFDRWFTSLDDTDRASVLAALLVLREKGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
MLCAGNKVGNERRFYDEMLLVADQEFTHWLDRLKERE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|