Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2512183..2512829 | Replicon | chromosome |
| Accession | NZ_CP109692 | ||
| Organism | Enterobacter asburiae strain 2017-45-80 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OI907_RS12445 | Protein ID | WP_033147058.1 |
| Coordinates | 2512183..2512533 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OI907_RS12450 | Protein ID | WP_023309874.1 |
| Coordinates | 2512530..2512829 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI907_RS12430 (OI907_12415) | 2507634..2509952 | - | 2319 | WP_033147056.1 | alpha-xylosidase | - |
| OI907_RS12435 (OI907_12420) | 2509965..2511356 | - | 1392 | WP_033147057.1 | glycoside-pentoside-hexuronide family transporter | - |
| OI907_RS12445 (OI907_12430) | 2512183..2512533 | + | 351 | WP_033147058.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OI907_RS12450 (OI907_12435) | 2512530..2512829 | + | 300 | WP_023309874.1 | XRE family transcriptional regulator | Antitoxin |
| OI907_RS12455 (OI907_12440) | 2512858..2513295 | - | 438 | WP_033147059.1 | acetyltransferase | - |
| OI907_RS12460 (OI907_12445) | 2513652..2514650 | - | 999 | WP_033147060.1 | class I SAM-dependent methyltransferase | - |
| OI907_RS12465 (OI907_12450) | 2514736..2515674 | - | 939 | WP_047059676.1 | helix-turn-helix domain-containing protein | - |
| OI907_RS12470 (OI907_12455) | 2515864..2516343 | - | 480 | WP_033147061.1 | hypothetical protein | - |
| OI907_RS12475 (OI907_12460) | 2516345..2517106 | - | 762 | WP_033147062.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13561.65 Da Isoelectric Point: 8.0081
>T261984 WP_033147058.1 NZ_CP109692:2512183-2512533 [Enterobacter asburiae]
MWTVLFGKVFEQWLLEQEEGLQDKVLADLLNLQKYGPRLPRPYADTVKGSWYNHMKELRIQYAGRPIRAFFAFDPVRQAI
VLCAGDKSNDKAFYEKMIRIADTEFSFHLTSLEATK
MWTVLFGKVFEQWLLEQEEGLQDKVLADLLNLQKYGPRLPRPYADTVKGSWYNHMKELRIQYAGRPIRAFFAFDPVRQAI
VLCAGDKSNDKAFYEKMIRIADTEFSFHLTSLEATK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|