Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 1811881..1812507 | Replicon | chromosome |
Accession | NZ_CP109619 | ||
Organism | Treponema denticola strain KCOM 3500 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q73NN6 |
Locus tag | OE909_RS08330 | Protein ID | WP_002677634.1 |
Coordinates | 1811881..1812189 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OE909_RS08335 | Protein ID | WP_002689588.1 |
Coordinates | 1812199..1812507 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OE909_RS08305 (OE909_08305) | 1807836..1808174 | + | 339 | WP_002670686.1 | anti-sigma factor antagonist | - |
OE909_RS08310 (OE909_08310) | 1808191..1808733 | + | 543 | WP_002670683.1 | ATP-binding protein | - |
OE909_RS08315 (OE909_08315) | 1808748..1809569 | - | 822 | WP_264306470.1 | hypothetical protein | - |
OE909_RS08320 (OE909_08320) | 1809550..1810170 | - | 621 | WP_002670678.1 | hypothetical protein | - |
OE909_RS08325 (OE909_08325) | 1810286..1811665 | + | 1380 | WP_264306471.1 | tyrosine phenol-lyase | - |
OE909_RS08330 (OE909_08330) | 1811881..1812189 | + | 309 | WP_002677634.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OE909_RS08335 (OE909_08335) | 1812199..1812507 | + | 309 | WP_002689588.1 | NadS family protein | Antitoxin |
OE909_RS08340 (OE909_08340) | 1812640..1813311 | + | 672 | WP_002670670.1 | TetR/AcrR family transcriptional regulator | - |
OE909_RS08345 (OE909_08345) | 1813400..1813816 | + | 417 | WP_245522456.1 | SRPBCC family protein | - |
OE909_RS08350 (OE909_08350) | 1813947..1814576 | - | 630 | WP_002670667.1 | adenylate kinase | - |
OE909_RS08355 (OE909_08355) | 1814634..1815863 | - | 1230 | WP_002670666.1 | cation:dicarboxylase symporter family transporter | - |
OE909_RS08360 (OE909_08360) | 1815902..1817221 | - | 1320 | WP_264306472.1 | leucine-rich repeat domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11736.96 Da Isoelectric Point: 10.6864
>T261962 WP_002677634.1 NZ_CP109619:1811881-1812189 [Treponema denticola]
MRIIETPVFTKQINRLLDEDTYKQFKEYLVCNPLKGKLIKGGGGIRKIRWSKKNTGKSGGIRIIYFIKTETKIYLLFAYS
KSDAESITKKQINMLASFIKGL
MRIIETPVFTKQINRLLDEDTYKQFKEYLVCNPLKGKLIKGGGGIRKIRWSKKNTGKSGGIRIIYFIKTETKIYLLFAYS
KSDAESITKKQINMLASFIKGL
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|