Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2680373..2680672 | Replicon | chromosome |
Accession | NZ_CP109611 | ||
Organism | Enterococcus faecalis strain AFL-109F |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OGM83_RS13025 | Protein ID | WP_271232318.1 |
Coordinates | 2680373..2680555 (+) | Length | 61 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2680488..2680672 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM83_RS13010 (2676160) | 2676160..2676759 | - | 600 | WP_225560887.1 | RloB family protein | - |
OGM83_RS13015 (2676768) | 2676768..2678063 | - | 1296 | WP_192177102.1 | ATP-binding protein | - |
OGM83_RS13020 (2678525) | 2678525..2680141 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
OGM83_RS13025 (2680373) | 2680373..2680555 | + | 183 | WP_271232318.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2680488) | 2680488..2680672 | - | 185 | NuclAT_9 | - | Antitoxin |
- (2680529) | 2680529..2680672 | - | 144 | NuclAT_12 | - | - |
OGM83_RS13030 (2680674) | 2680674..2680814 | + | 141 | WP_116593266.1 | putative holin-like toxin | - |
- (2680747) | 2680747..2681006 | - | 260 | NuclAT_8 | - | - |
- (2680958) | 2680958..2681007 | + | 50 | NuclAT_14 | - | - |
- (2680788) | 2680788..2681008 | - | 221 | NuclAT_11 | - | - |
OGM83_RS13035 (2681009) | 2681009..2684008 | - | 3000 | WP_283658617.1 | WxL domain-containing protein | - |
OGM83_RS13040 (2683989) | 2683989..2684357 | - | 369 | WP_096398072.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6996.46 Da Isoelectric Point: 10.8172
>T261936 WP_271232318.1 NZ_CP109611:2680373-2680555 [Enterococcus faecalis]
MAVAIQSEREVMRMHVFPKFRERRGLLSAYETIQTILGFGMFTIDLIALIVKLLKNDKKK
MAVAIQSEREVMRMHVFPKFRERRGLLSAYETIQTILGFGMFTIDLIALIVKLLKNDKKK
Download Length: 183 bp
Antitoxin
Download Length: 185 bp
>AT261936 NZ_CP109611:c2680672-2680488 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTCAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAATCAATGGTAAACATACCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTCAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGCGCA
ATCAAATCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|