Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-RNAII/- |
Location | 2608155..2608413 | Replicon | chromosome |
Accession | NZ_CP109611 | ||
Organism | Enterococcus faecalis strain AFL-109F |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | OGM83_RS12695 | Protein ID | WP_002392696.1 |
Coordinates | 2608270..2608413 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2608155..2608337 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM83_RS12680 (2603716) | 2603716..2604429 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
OGM83_RS12685 (2604691) | 2604691..2607435 | + | 2745 | WP_283658616.1 | glycosyl hydrolase family 65 protein | - |
OGM83_RS12690 (2607450) | 2607450..2608100 | + | 651 | WP_033597602.1 | beta-phosphoglucomutase | - |
- (2608169) | 2608169..2608296 | + | 128 | NuclAT_13 | - | - |
- (2608155) | 2608155..2608337 | + | 183 | NuclAT_10 | - | Antitoxin |
OGM83_RS12695 (2608270) | 2608270..2608413 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OGM83_RS12700 (2608644) | 2608644..2609615 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
OGM83_RS12705 (2609790) | 2609790..2610227 | - | 438 | WP_271232303.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OGM83_RS12710 (2610360) | 2610360..2610914 | - | 555 | WP_002354869.1 | Maf family protein | - |
OGM83_RS12715 (2610939) | 2610939..2613071 | - | 2133 | WP_057086606.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T261933 WP_002392696.1 NZ_CP109611:c2608413-2608270 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 183 bp
>AT261933 NZ_CP109611:2608155-2608337 [Enterococcus faecalis]
TGCTAGAATGTAGATGAAAAGAGAGCTGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACTTTTTGAAT
TATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGTGCAAT
CAAAGCAATGGTAAACATACCAA
TGCTAGAATGTAGATGAAAAGAGAGCTGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACTTTTTGAAT
TATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGTGCAAT
CAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|