Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 326847..327041 | Replicon | chromosome |
Accession | NZ_CP109611 | ||
Organism | Enterococcus faecalis strain AFL-109F |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OGM83_RS01660 | Protein ID | WP_015543884.1 |
Coordinates | 326946..327041 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 326847..326911 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM83_RS01645 (322474) | 322474..324222 | + | 1749 | WP_161975114.1 | PTS transporter subunit EIIC | - |
OGM83_RS01650 (324213) | 324213..326246 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
OGM83_RS01655 (326257) | 326257..326691 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (326847) | 326847..326911 | + | 65 | NuclAT_15 | - | Antitoxin |
OGM83_RS01660 (326946) | 326946..327041 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OGM83_RS01665 (327287) | 327287..329059 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
OGM83_RS01670 (329074) | 329074..329511 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OGM83_RS01675 (329526) | 329526..330680 | + | 1155 | WP_010775146.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OGM83_RS01680 (330747) | 330747..331862 | - | 1116 | WP_010707863.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T261922 WP_015543884.1 NZ_CP109611:c327041-326946 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT261922 NZ_CP109611:326847-326911 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|