Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4277552..4278251 | Replicon | chromosome |
Accession | NZ_CP109606 | ||
Organism | Pseudomonas putida strain QH1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | A0A550F6I7 |
Locus tag | OGV21_RS19375 | Protein ID | WP_019750831.1 |
Coordinates | 4277955..4278251 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | A0A7D5VVT2 |
Locus tag | OGV21_RS19370 | Protein ID | WP_029380550.1 |
Coordinates | 4277552..4277953 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV21_RS19350 | 4272673..4273494 | - | 822 | WP_003254229.1 | transporter substrate-binding domain-containing protein | - |
OGV21_RS19355 | 4273570..4274511 | - | 942 | WP_047604111.1 | FAD-binding protein | - |
OGV21_RS19360 | 4274513..4275262 | - | 750 | WP_003254232.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
OGV21_RS19365 | 4275798..4277480 | + | 1683 | WP_023389616.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
OGV21_RS19370 | 4277552..4277953 | - | 402 | WP_029380550.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
OGV21_RS19375 | 4277955..4278251 | - | 297 | WP_019750831.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
OGV21_RS19380 | 4278346..4279671 | - | 1326 | WP_004573659.1 | MFS transporter | - |
OGV21_RS19385 | 4279744..4280223 | - | 480 | WP_264316358.1 | histidine kinase | - |
OGV21_RS19390 | 4280392..4280868 | - | 477 | WP_003254241.1 | sigma-70 family RNA polymerase sigma factor | - |
OGV21_RS19395 | 4280990..4282615 | - | 1626 | WP_264316359.1 | twin-arginine translocation signal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11094.88 Da Isoelectric Point: 9.8759
>T261902 WP_019750831.1 NZ_CP109606:c4278251-4277955 [Pseudomonas putida]
MEKRTPHCPLHRLQVLLSQGKVRTTQAATLGARSLGLGPYDMLDVVRGLSPGDFHKSMTSYNDHRIWQDVYRAQTAVGRV
YLKLTVVDDLLILSFKEL
MEKRTPHCPLHRLQVLLSQGKVRTTQAATLGARSLGLGPYDMLDVVRGLSPGDFHKSMTSYNDHRIWQDVYRAQTAVGRV
YLKLTVVDDLLILSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14692.91 Da Isoelectric Point: 4.9749
>AT261902 WP_029380550.1 NZ_CP109606:c4277953-4277552 [Pseudomonas putida]
MKCPLCGGAELVAQSRDMPYRYKGEATVIPDIFGDYCPTCGEAVLGMDEAQRMSDLMTAFERKVNAAVVDPGFIAAMRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
MKCPLCGGAELVAQSRDMPYRYKGEATVIPDIFGDYCPTCGEAVLGMDEAQRMSDLMTAFERKVNAAVVDPGFIAAMRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A550F6I7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D5VVT2 |