Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3777611..3778208 | Replicon | chromosome |
Accession | NZ_CP109604 | ||
Organism | Klebsiella pneumoniae strain KP2022 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | KP2022_RS18515 | Protein ID | WP_004142563.1 |
Coordinates | 3777891..3778208 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | KP2022_RS18510 | Protein ID | WP_004142561.1 |
Coordinates | 3777611..3777898 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KP2022_RS18480 (3773691) | 3773691..3773939 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
KP2022_RS18485 (3773957) | 3773957..3774298 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
KP2022_RS18490 (3774329) | 3774329..3775444 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
KP2022_RS18495 (3775624) | 3775624..3776208 | + | 585 | WP_002893026.1 | TetR/AcrR family transcriptional regulator | - |
KP2022_RS18500 (3776205) | 3776205..3776573 | + | 369 | WP_002893024.1 | MmcQ/YjbR family DNA-binding protein | - |
KP2022_RS18505 (3776693) | 3776693..3777346 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
KP2022_RS18510 (3777611) | 3777611..3777898 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
KP2022_RS18515 (3777891) | 3777891..3778208 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KP2022_RS18520 (3778393) | 3778393..3779436 | - | 1044 | WP_087761125.1 | DUF2157 domain-containing protein | - |
KP2022_RS18525 (3780102) | 3780102..3780968 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
KP2022_RS18530 (3781077) | 3781077..3782504 | + | 1428 | WP_129073911.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T261892 WP_004142563.1 NZ_CP109604:c3778208-3777891 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |