Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 324112..324698 | Replicon | chromosome |
| Accession | NZ_CP109604 | ||
| Organism | Klebsiella pneumoniae strain KP2022 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A483YV82 |
| Locus tag | KP2022_RS01505 | Protein ID | WP_019725145.1 |
| Coordinates | 324330..324698 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A483YZZ9 |
| Locus tag | KP2022_RS01500 | Protein ID | WP_019725146.1 |
| Coordinates | 324112..324333 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP2022_RS01480 (320269) | 320269..321195 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| KP2022_RS01485 (321192) | 321192..322469 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| KP2022_RS01490 (322466) | 322466..323233 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| KP2022_RS01495 (323235) | 323235..323948 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| KP2022_RS01500 (324112) | 324112..324333 | + | 222 | WP_019725146.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| KP2022_RS01505 (324330) | 324330..324698 | + | 369 | WP_019725145.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| KP2022_RS01510 (324970) | 324970..326286 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| KP2022_RS01515 (326393) | 326393..327280 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| KP2022_RS01520 (327277) | 327277..328122 | + | 846 | WP_004185988.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| KP2022_RS01525 (328124) | 328124..329194 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 321192..329931 | 8739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13542.89 Da Isoelectric Point: 8.6410
>T261884 WP_019725145.1 NZ_CP109604:324330-324698 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFIKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFIKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483YV82 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483YZZ9 |