Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324112..324698 Replicon chromosome
Accession NZ_CP109604
Organism Klebsiella pneumoniae strain KP2022

Toxin (Protein)


Gene name doc Uniprot ID A0A483YV82
Locus tag KP2022_RS01505 Protein ID WP_019725145.1
Coordinates 324330..324698 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag KP2022_RS01500 Protein ID WP_019725146.1
Coordinates 324112..324333 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP2022_RS01480 (320269) 320269..321195 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
KP2022_RS01485 (321192) 321192..322469 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
KP2022_RS01490 (322466) 322466..323233 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
KP2022_RS01495 (323235) 323235..323948 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
KP2022_RS01500 (324112) 324112..324333 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KP2022_RS01505 (324330) 324330..324698 + 369 WP_019725145.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KP2022_RS01510 (324970) 324970..326286 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
KP2022_RS01515 (326393) 326393..327280 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
KP2022_RS01520 (327277) 327277..328122 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
KP2022_RS01525 (328124) 328124..329194 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321192..329931 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T261884 WP_019725145.1 NZ_CP109604:324330-324698 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFIKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT261884 WP_019725146.1 NZ_CP109604:324112-324333 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483YV82

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References