Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 983722..984422 | Replicon | chromosome |
Accession | NZ_CP109603 | ||
Organism | Pseudomonas putida strain SEH01 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | OGV19_RS04460 | Protein ID | WP_264312310.1 |
Coordinates | 983722..984018 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | OGV19_RS04465 | Protein ID | WP_264312311.1 |
Coordinates | 984021..984422 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV19_RS04440 | 979711..980880 | - | 1170 | WP_264312306.1 | efflux RND transporter periplasmic adaptor subunit | - |
OGV19_RS04445 | 981106..981582 | + | 477 | WP_264312307.1 | sigma-70 family RNA polymerase sigma factor | - |
OGV19_RS04450 | 981753..982232 | + | 480 | WP_264312308.1 | histidine kinase | - |
OGV19_RS04455 | 982302..983627 | + | 1326 | WP_264312309.1 | MFS transporter | - |
OGV19_RS04460 | 983722..984018 | + | 297 | WP_264312310.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
OGV19_RS04465 | 984021..984422 | + | 402 | WP_264312311.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
OGV19_RS04470 | 984495..986177 | - | 1683 | WP_264312312.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
OGV19_RS04475 | 986716..987465 | + | 750 | WP_027592887.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
OGV19_RS04480 | 987466..988395 | + | 930 | WP_264312313.1 | FAD-binding protein | - |
OGV19_RS04485 | 988486..989307 | + | 822 | WP_264312314.1 | transporter substrate-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11222.09 Da Isoelectric Point: 8.0063
>T261878 WP_264312310.1 NZ_CP109603:983722-984018 [Pseudomonas putida]
MEKRTPHCPLELIRALVGAGRISPTTASLRGAQALGMEYPDMLDVINGLERRDFYKSMTSYVDHRVWQDVYRPLTVKGYV
YLKLSVVDDVLIVSFKEM
MEKRTPHCPLELIRALVGAGRISPTTASLRGAQALGMEYPDMLDVINGLERRDFYKSMTSYVDHRVWQDVYRPLTVKGYV
YLKLSVVDDVLIVSFKEM
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14627.64 Da Isoelectric Point: 5.2321
>AT261878 WP_264312311.1 NZ_CP109603:984021-984422 [Pseudomonas putida]
MRCPICGGAELAPDTQDMPYRYKGEATLIPNVSGDYCSACGEAVLSHDEAMRISDLMSAFNRQVNAAAVDPGFIVSVRKK
FDLDQREAGEIFGGGVNAFSRYENGKTRPPVALVKLFKLLDRHPELFEEVRTA
MRCPICGGAELAPDTQDMPYRYKGEATLIPNVSGDYCSACGEAVLSHDEAMRISDLMSAFNRQVNAAAVDPGFIVSVRKK
FDLDQREAGEIFGGGVNAFSRYENGKTRPPVALVKLFKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|