Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 310746..311350 | Replicon | chromosome |
Accession | NZ_CP109603 | ||
Organism | Pseudomonas putida strain SEH01 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OGV19_RS01450 | Protein ID | WP_264311801.1 |
Coordinates | 311030..311350 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OGV19_RS01445 | Protein ID | WP_264311800.1 |
Coordinates | 310746..311033 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV19_RS01435 | 306759..309140 | + | 2382 | WP_264311798.1 | TonB-dependent receptor | - |
OGV19_RS01440 | 309148..310731 | + | 1584 | WP_264311799.1 | alpha/beta hydrolase-fold protein | - |
OGV19_RS01445 | 310746..311033 | - | 288 | WP_264311800.1 | NadS family protein | Antitoxin |
OGV19_RS01450 | 311030..311350 | - | 321 | WP_264311801.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGV19_RS01455 | 311504..313201 | - | 1698 | WP_264311802.1 | SulP family inorganic anion transporter | - |
OGV19_RS01465 | 313613..314497 | - | 885 | WP_264311803.1 | alpha/beta hydrolase | - |
OGV19_RS01470 | 314948..315640 | - | 693 | WP_264311804.1 | 16S rRNA pseudouridine(516) synthase | - |
OGV19_RS01475 | 315674..315895 | - | 222 | WP_264311805.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12257.22 Da Isoelectric Point: 10.0949
>T261876 WP_264311801.1 NZ_CP109603:c311350-311030 [Pseudomonas putida]
MLFTETPLFTKRVKDLLEDDEYRLLQIRLMAQPDTGDLIEGTGGLRKVRIAANGHGKRGGARVIYYHFISKSQIAMLYIY
PKNEQPDLSAEQRKALKKIIENWRHA
MLFTETPLFTKRVKDLLEDDEYRLLQIRLMAQPDTGDLIEGTGGLRKVRIAANGHGKRGGARVIYYHFISKSQIAMLYIY
PKNEQPDLSAEQRKALKKIIENWRHA
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|