Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 84068..84494 | Replicon | plasmid p1 |
| Accession | NZ_CP109602 | ||
| Organism | Escherichia coli strain TL-14 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OGV15_RS23680 | Protein ID | WP_001372321.1 |
| Coordinates | 84068..84193 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 84270..84494 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGV15_RS23645 (79439) | 79439..80128 | - | 690 | WP_000283383.1 | conjugal transfer transcriptional regulator TraJ | - |
| OGV15_RS23650 (80315) | 80315..80698 | - | 384 | WP_001151528.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OGV15_RS23655 (81019) | 81019..81621 | + | 603 | WP_000243710.1 | transglycosylase SLT domain-containing protein | - |
| OGV15_RS23660 (81918) | 81918..82739 | - | 822 | WP_074147530.1 | DUF932 domain-containing protein | - |
| OGV15_RS23665 (82861) | 82861..83147 | - | 287 | Protein_88 | hypothetical protein | - |
| OGV15_RS23670 (83172) | 83172..83378 | - | 207 | WP_015059635.1 | hypothetical protein | - |
| OGV15_RS23675 (83448) | 83448..83621 | + | 174 | Protein_90 | hypothetical protein | - |
| OGV15_RS23680 (84068) | 84068..84193 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OGV15_RS23685 (84135) | 84135..84284 | - | 150 | Protein_92 | plasmid maintenance protein Mok | - |
| - (84270) | 84270..84494 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (84270) | 84270..84494 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (84270) | 84270..84494 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (84270) | 84270..84494 | - | 225 | NuclAT_0 | - | Antitoxin |
| OGV15_RS23690 (84306) | 84306..84494 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| OGV15_RS23695 (84463) | 84463..85225 | - | 763 | Protein_94 | plasmid SOS inhibition protein A | - |
| OGV15_RS23700 (85222) | 85222..85656 | - | 435 | WP_000845932.1 | conjugation system SOS inhibitor PsiB | - |
| OGV15_RS23705 (85711) | 85711..87669 | - | 1959 | Protein_96 | ParB/RepB/Spo0J family partition protein | - |
| OGV15_RS23710 (87734) | 87734..87967 | - | 234 | WP_000006030.1 | DUF905 family protein | - |
| OGV15_RS23715 (88029) | 88029..88568 | - | 540 | WP_000290812.1 | single-stranded DNA-binding protein | - |
| OGV15_RS23720 (88594) | 88594..88800 | - | 207 | WP_000547971.1 | hypothetical protein | - |
| OGV15_RS23725 (89041) | 89041..89310 | - | 270 | WP_071977877.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(B) / aph(3'')-Ib / aph(6)-Id | espP / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..145661 | 145661 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261872 WP_001372321.1 NZ_CP109602:c84193-84068 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT261872 NZ_CP109602:c84494-84270 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|