Detailed information of TA system TA261872

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 84068..84494
• Replicon: plasmid p1
• Accession: NZ_CP109602
• Organism: Escherichia coli strain TL-14

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OGV15_RS23680
• Protein ID: WP_001372321.1
• Coordinates: 84068..84193 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	84270..84494 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OGV15_RS23645 (79439)	79439..80128	-	690	WP_000283383.1	conjugal transfer transcriptional regulator TraJ	-
OGV15_RS23650 (80315)	80315..80698	-	384	WP_001151528.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OGV15_RS23655 (81019)	81019..81621	+	603	WP_000243710.1	transglycosylase SLT domain-containing protein	-
OGV15_RS23660 (81918)	81918..82739	-	822	WP_074147530.1	DUF932 domain-containing protein	-
OGV15_RS23665 (82861)	82861..83147	-	287	Protein_88	hypothetical protein	-
OGV15_RS23670 (83172)	83172..83378	-	207	WP_015059635.1	hypothetical protein	-
OGV15_RS23675 (83448)	83448..83621	+	174	Protein_90	hypothetical protein	-
OGV15_RS23680 (84068)	84068..84193	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OGV15_RS23685 (84135)	84135..84284	-	150	Protein_92	plasmid maintenance protein Mok	-
- (84270)	84270..84494	-	225	NuclAT_0	-	Antitoxin
- (84270)	84270..84494	-	225	NuclAT_0	-	Antitoxin
- (84270)	84270..84494	-	225	NuclAT_0	-	Antitoxin
- (84270)	84270..84494	-	225	NuclAT_0	-	Antitoxin
OGV15_RS23690 (84306)	84306..84494	+	189	WP_001299721.1	hypothetical protein	-
OGV15_RS23695 (84463)	84463..85225	-	763	Protein_94	plasmid SOS inhibition protein A	-
OGV15_RS23700 (85222)	85222..85656	-	435	WP_000845932.1	conjugation system SOS inhibitor PsiB	-
OGV15_RS23705 (85711)	85711..87669	-	1959	Protein_96	ParB/RepB/Spo0J family partition protein	-
OGV15_RS23710 (87734)	87734..87967	-	234	WP_000006030.1	DUF905 family protein	-
OGV15_RS23715 (88029)	88029..88568	-	540	WP_000290812.1	single-stranded DNA-binding protein	-
OGV15_RS23720 (88594)	88594..88800	-	207	WP_000547971.1	hypothetical protein	-
OGV15_RS23725 (89041)	89041..89310	-	270	WP_071977877.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / tet(B) / aph(3'')-Ib / aph(6)-Id	espP / faeJ / faeI / faeH / faeF / faeE / faeD / faeC	1..145661	145661

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T261872 WP_001372321.1 NZ_CP109602:c84193-84068 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT261872 NZ_CP109602:c84494-84270 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin