Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 44454..44708 | Replicon | plasmid p1 |
| Accession | NZ_CP109602 | ||
| Organism | Escherichia coli strain TL-14 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | Q0H0B2 |
| Locus tag | OGV15_RS23445 | Protein ID | WP_001300273.1 |
| Coordinates | 44454..44603 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 44647..44708 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGV15_RS23410 (40072) | 40072..41049 | - | 978 | WP_050947967.1 | DUF4238 domain-containing protein | - |
| OGV15_RS23415 (41190) | 41190..41489 | - | 300 | WP_016241863.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OGV15_RS23420 (41479) | 41479..41742 | - | 264 | WP_016241862.1 | hypothetical protein | - |
| OGV15_RS23425 (42751) | 42751..43608 | - | 858 | WP_000131011.1 | incFII family plasmid replication initiator RepA | - |
| OGV15_RS23430 (43601) | 43601..43675 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| OGV15_RS23435 (43724) | 43724..43849 | + | 126 | WP_015059569.1 | hypothetical protein | - |
| OGV15_RS23440 (43922) | 43922..44170 | - | 249 | WP_021512942.1 | replication regulatory protein RepA | - |
| OGV15_RS23445 (44454) | 44454..44603 | - | 150 | WP_001300273.1 | Hok/Gef family protein | Toxin |
| - (44647) | 44647..44708 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (44647) | 44647..44708 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (44647) | 44647..44708 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (44647) | 44647..44708 | + | 62 | NuclAT_1 | - | Antitoxin |
| OGV15_RS23450 (44883) | 44883..45017 | - | 135 | WP_001058542.1 | hypothetical protein | - |
| OGV15_RS23455 (45368) | 45368..45829 | - | 462 | WP_000760078.1 | thermonuclease family protein | - |
| OGV15_RS23460 (46572) | 46572..46775 | - | 204 | WP_001327131.1 | hypothetical protein | - |
| OGV15_RS23465 (46930) | 46930..47487 | - | 558 | WP_000139312.1 | fertility inhibition protein FinO | - |
| OGV15_RS23470 (47590) | 47590..48450 | - | 861 | WP_000704512.1 | alpha/beta hydrolase | - |
| OGV15_RS23475 (48509) | 48509..49255 | - | 747 | WP_000205745.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / tet(B) / aph(3'')-Ib / aph(6)-Id | espP / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..145661 | 145661 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5554.72 Da Isoelectric Point: 8.7678
>T261867 WP_001300273.1 NZ_CP109602:c44603-44454 [Escherichia coli]
MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT261867 NZ_CP109602:44647-44708 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
