Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3710700..3711394 | Replicon | chromosome |
Accession | NZ_CP109601 | ||
Organism | Escherichia coli strain TL-14 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | OGV15_RS18135 | Protein ID | WP_001263489.1 |
Coordinates | 3710700..3711098 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | OGV15_RS18140 | Protein ID | WP_000554758.1 |
Coordinates | 3711101..3711394 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3706288) | 3706288..3706368 | - | 81 | NuclAT_11 | - | - |
- (3706288) | 3706288..3706368 | - | 81 | NuclAT_11 | - | - |
- (3706288) | 3706288..3706368 | - | 81 | NuclAT_11 | - | - |
- (3706288) | 3706288..3706368 | - | 81 | NuclAT_11 | - | - |
OGV15_RS18110 (3706964) | 3706964..3707422 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
OGV15_RS18115 (3707683) | 3707683..3709140 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
OGV15_RS18120 (3709197) | 3709197..3709718 | - | 522 | Protein_3544 | peptide chain release factor H | - |
OGV15_RS18125 (3709714) | 3709714..3709920 | - | 207 | Protein_3545 | RtcB family protein | - |
OGV15_RS18130 (3710238) | 3710238..3710690 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
OGV15_RS18135 (3710700) | 3710700..3711098 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
OGV15_RS18140 (3711101) | 3711101..3711394 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OGV15_RS18145 (3711446) | 3711446..3712501 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
OGV15_RS18150 (3712572) | 3712572..3713357 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
OGV15_RS18155 (3713329) | 3713329..3715041 | + | 1713 | Protein_3551 | flagellar biosynthesis protein FlhA | - |
OGV15_RS18160 (3715265) | 3715265..3715762 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T261862 WP_001263489.1 NZ_CP109601:c3711098-3710700 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |