Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 779727..780420 | Replicon | chromosome |
Accession | NZ_CP109601 | ||
Organism | Escherichia coli strain TL-14 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | OGV15_RS03800 | Protein ID | WP_000415584.1 |
Coordinates | 779727..780023 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | OGV15_RS03805 | Protein ID | WP_000650107.1 |
Coordinates | 780025..780420 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV15_RS03765 (774814) | 774814..775128 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
OGV15_RS03770 (775159) | 775159..775740 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
OGV15_RS03775 (776059) | 776059..776391 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
OGV15_RS03780 (776437) | 776437..777786 | - | 1350 | WP_001618857.1 | quorum sensing histidine kinase QseC | - |
OGV15_RS03785 (777783) | 777783..778442 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
OGV15_RS03790 (778594) | 778594..778986 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
OGV15_RS03795 (779039) | 779039..779522 | + | 484 | Protein_744 | GyrI-like domain-containing protein | - |
OGV15_RS03800 (779727) | 779727..780023 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
OGV15_RS03805 (780025) | 780025..780420 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
OGV15_RS03810 (780553) | 780553..782160 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
OGV15_RS03815 (782298) | 782298..784556 | + | 2259 | WP_049253102.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T261849 WP_000415584.1 NZ_CP109601:779727-780023 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT261849 WP_000650107.1 NZ_CP109601:780025-780420 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|