Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 715154..715881 | Replicon | chromosome |
Accession | NZ_CP109601 | ||
Organism | Escherichia coli strain TL-14 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | OGV15_RS03495 | Protein ID | WP_000550189.1 |
Coordinates | 715154..715468 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OGV15_RS03500 | Protein ID | WP_000560266.1 |
Coordinates | 715465..715881 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV15_RS03475 (711321) | 711321..712307 | - | 987 | WP_023281494.1 | Gfo/Idh/MocA family oxidoreductase | - |
OGV15_RS03480 (712386) | 712386..713069 | - | 684 | WP_001183042.1 | vancomycin high temperature exclusion protein | - |
OGV15_RS03485 (713146) | 713146..713649 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
OGV15_RS03490 (713734) | 713734..714870 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
OGV15_RS03495 (715154) | 715154..715468 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
OGV15_RS03500 (715465) | 715465..715881 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
OGV15_RS03505 (715926) | 715926..717944 | - | 2019 | WP_049253702.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
OGV15_RS03510 (718370) | 718370..720721 | - | 2352 | WP_024238710.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T261848 WP_000550189.1 NZ_CP109601:715154-715468 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT261848 WP_000560266.1 NZ_CP109601:715465-715881 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|