Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2415801..2416172 | Replicon | chromosome |
Accession | NZ_CP107720 | ||
Organism | Escherichia coli strain 2021CK-01361 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | N4T39_RS11740 | Protein ID | WP_001317028.1 |
Coordinates | 2415978..2416172 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2415801..2415979 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T39_RS11710 (2411553) | 2411553..2411726 | + | 174 | WP_001296046.1 | protein YnaL | - |
N4T39_RS11715 (2411756) | 2411756..2413129 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
N4T39_RS11720 (2413258) | 2413258..2414193 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
N4T39_RS11725 (2414245) | 2414245..2415480 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
N4T39_RS11730 (2415482) | 2415482..2415697 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2415801) | 2415801..2415979 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2415801) | 2415801..2415979 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2415801) | 2415801..2415979 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2415801) | 2415801..2415979 | + | 179 | NuclAT_0 | - | Antitoxin |
N4T39_RS11735 (2415776) | 2415776..2415985 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
N4T39_RS11740 (2415978) | 2415978..2416172 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
N4T39_RS11745 (2416229) | 2416229..2417038 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
N4T39_RS11750 (2417031) | 2417031..2419631 | - | 2601 | WP_001549183.1 | exodeoxyribonuclease VIII | - |
N4T39_RS11755 (2419733) | 2419733..2420008 | - | 276 | WP_000632297.1 | protein RacC | - |
N4T39_RS11760 (2420083) | 2420083..2420253 | - | 171 | WP_001352098.1 | YdaE family protein | - |
N4T39_RS11765 (2420253) | 2420253..2420474 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2414245..2426002 | 11757 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T261828 WP_001317028.1 NZ_CP107720:c2416172-2415978 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT261828 NZ_CP107720:2415801-2415979 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|