Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1173996..1174723 | Replicon | chromosome |
| Accession | NZ_CP107720 | ||
| Organism | Escherichia coli strain 2021CK-01361 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | N4T39_RS05675 | Protein ID | WP_000547564.1 |
| Coordinates | 1173996..1174307 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N4T39_RS05680 | Protein ID | WP_000126294.1 |
| Coordinates | 1174304..1174723 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T39_RS05645 (1169138) | 1169138..1170847 | + | 1710 | WP_001288140.1 | formate hydrogenlyase subunit HycE | - |
| N4T39_RS05650 (1170857) | 1170857..1171399 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| N4T39_RS05655 (1171399) | 1171399..1172166 | + | 768 | WP_000067401.1 | formate hydrogenlyase subunit HycG | - |
| N4T39_RS05660 (1172163) | 1172163..1172573 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| N4T39_RS05665 (1172566) | 1172566..1173036 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| N4T39_RS05670 (1173061) | 1173061..1173822 | + | 762 | WP_001026446.1 | hypothetical protein | - |
| N4T39_RS05675 (1173996) | 1173996..1174307 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N4T39_RS05680 (1174304) | 1174304..1174723 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N4T39_RS05685 (1174837) | 1174837..1176261 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| N4T39_RS05690 (1176270) | 1176270..1177727 | - | 1458 | WP_001107882.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| N4T39_RS05695 (1177987) | 1177987..1178997 | + | 1011 | WP_001402444.1 | DNA-binding transcriptional regulator AscG | - |
| N4T39_RS05700 (1179146) | 1179146..1179673 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T261822 WP_000547564.1 NZ_CP107720:1173996-1174307 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT261822 WP_000126294.1 NZ_CP107720:1174304-1174723 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|