Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 659137..659936 | Replicon | chromosome |
Accession | NZ_CP107720 | ||
Organism | Escherichia coli strain 2021CK-01361 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | D7XZ20 |
Locus tag | N4T39_RS03220 | Protein ID | WP_000347264.1 |
Coordinates | 659137..659601 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N4T39_RS03225 | Protein ID | WP_001307405.1 |
Coordinates | 659601..659936 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T39_RS03190 (654138) | 654138..654572 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
N4T39_RS03195 (654590) | 654590..655468 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N4T39_RS03200 (655458) | 655458..656237 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N4T39_RS03205 (656248) | 656248..656721 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N4T39_RS03210 (656744) | 656744..658024 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N4T39_RS03215 (658273) | 658273..659082 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N4T39_RS03220 (659137) | 659137..659601 | - | 465 | WP_000347264.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N4T39_RS03225 (659601) | 659601..659936 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N4T39_RS03230 (660085) | 660085..661656 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
N4T39_RS03235 (662031) | 662031..663365 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
N4T39_RS03240 (663381) | 663381..664151 | + | 771 | WP_001058207.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17894.29 Da Isoelectric Point: 9.4945
>T261817 WP_000347264.1 NZ_CP107720:c659601-659137 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFDAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFDAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A241QML2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |