Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4592..5243 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107602 | ||
| Organism | Acinetobacter baumannii strain 1326589 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V2UF49 |
| Locus tag | OIO85_RS19125 | Protein ID | WP_000269909.1 |
| Coordinates | 4887..5243 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OIO85_RS19120 | Protein ID | WP_001140621.1 |
| Coordinates | 4592..4894 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO85_RS19095 (OIO85_19100) | 171..458 | + | 288 | WP_000438827.1 | BrnT family toxin | - |
| OIO85_RS19100 (OIO85_19105) | 445..759 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | - |
| OIO85_RS19105 (OIO85_19110) | 887..3298 | + | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
| OIO85_RS19110 (OIO85_19115) | 3603..4064 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
| OIO85_RS19115 (OIO85_19120) | 4390..4599 | - | 210 | WP_000069474.1 | hypothetical protein | - |
| OIO85_RS19120 (OIO85_19125) | 4592..4894 | - | 303 | WP_001140621.1 | XRE family transcriptional regulator | Antitoxin |
| OIO85_RS19125 (OIO85_19130) | 4887..5243 | - | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OIO85_RS19130 (OIO85_19135) | 6049..6882 | - | 834 | WP_000439570.1 | S-formylglutathione hydrolase | - |
| OIO85_RS19135 (OIO85_19140) | 7356..7754 | - | 399 | WP_000235176.1 | VOC family protein | - |
| OIO85_RS19140 (OIO85_19145) | 7807..8916 | - | 1110 | WP_000842148.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
| OIO85_RS19145 (OIO85_19150) | 8938..9213 | - | 276 | WP_001133626.1 | metal/formaldehyde-sensitive transcriptional repressor | - |
| OIO85_RS19150 (OIO85_19155) | 9799..9945 | + | 147 | WP_001983317.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13515.49 Da Isoelectric Point: 6.4631
>T261792 WP_000269909.1 NZ_CP107602:c5243-4887 [Acinetobacter baumannii]
MWTVITTDLFNEWLVQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
MWTVITTDLFNEWLVQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|