Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 14386..15037 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107598 | ||
| Organism | Acinetobacter baumannii strain 1326581-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V2UF49 |
| Locus tag | OIO78_RS19120 | Protein ID | WP_000269909.1 |
| Coordinates | 14386..14742 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OIO78_RS19125 | Protein ID | WP_001140621.1 |
| Coordinates | 14735..15037 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO78_RS19095 (OIO78_19100) | 11949..12161 | + | 213 | WP_000687427.1 | hypothetical protein | - |
| OIO78_RS19100 (OIO78_19105) | 12443..12619 | + | 177 | WP_000246872.1 | hypothetical protein | - |
| OIO78_RS19105 (OIO78_19110) | 12655..13149 | + | 495 | WP_000999995.1 | hypothetical protein | - |
| OIO78_RS19110 (OIO78_19115) | 13164..13448 | - | 285 | WP_001071102.1 | hypothetical protein | - |
| OIO78_RS19115 (OIO78_19120) | 13542..13844 | + | 303 | WP_000702763.1 | hypothetical protein | - |
| OIO78_RS19120 (OIO78_19125) | 14386..14742 | + | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OIO78_RS19125 (OIO78_19130) | 14735..15037 | + | 303 | WP_001140621.1 | XRE family transcriptional regulator | Antitoxin |
| OIO78_RS19130 (OIO78_19135) | 15030..15239 | + | 210 | WP_000069474.1 | hypothetical protein | - |
| OIO78_RS19135 (OIO78_19140) | 15565..16026 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
| OIO78_RS19140 (OIO78_19145) | 16331..18742 | - | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
| OIO78_RS19145 (OIO78_19150) | 18870..19184 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | - |
| OIO78_RS19150 (OIO78_19155) | 19171..19458 | - | 288 | WP_000438827.1 | BrnT family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13515.49 Da Isoelectric Point: 6.4631
>T261786 WP_000269909.1 NZ_CP107598:14386-14742 [Acinetobacter baumannii]
MWTVITTDLFNEWLVQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
MWTVITTDLFNEWLVQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|