Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4591..5242 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107596 | ||
Organism | Acinetobacter baumannii strain 1326581-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V2UF49 |
Locus tag | OIO65_RS19055 | Protein ID | WP_000269909.1 |
Coordinates | 4886..5242 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OIO65_RS19050 | Protein ID | WP_001140621.1 |
Coordinates | 4591..4893 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO65_RS19025 (OIO65_19030) | 170..457 | + | 288 | WP_000438827.1 | BrnT family toxin | - |
OIO65_RS19030 (OIO65_19035) | 444..758 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | - |
OIO65_RS19035 (OIO65_19040) | 886..3297 | + | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
OIO65_RS19040 (OIO65_19045) | 3602..4063 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
OIO65_RS19045 (OIO65_19050) | 4389..4598 | - | 210 | WP_000069474.1 | hypothetical protein | - |
OIO65_RS19050 (OIO65_19055) | 4591..4893 | - | 303 | WP_001140621.1 | XRE family transcriptional regulator | Antitoxin |
OIO65_RS19055 (OIO65_19060) | 4886..5242 | - | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OIO65_RS19060 (OIO65_19065) | 6048..6881 | - | 834 | WP_000439570.1 | S-formylglutathione hydrolase | - |
OIO65_RS19065 (OIO65_19070) | 7355..7753 | - | 399 | WP_000235176.1 | VOC family protein | - |
OIO65_RS19070 (OIO65_19075) | 7806..8915 | - | 1110 | WP_000842148.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
OIO65_RS19075 (OIO65_19080) | 8937..9212 | - | 276 | WP_001133626.1 | metal/formaldehyde-sensitive transcriptional repressor | - |
OIO65_RS19080 (OIO65_19085) | 9798..9944 | + | 147 | WP_001983317.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13515.49 Da Isoelectric Point: 6.4631
>T261784 WP_000269909.1 NZ_CP107596:c5242-4886 [Acinetobacter baumannii]
MWTVITTDLFNEWLVQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
MWTVITTDLFNEWLVQQDESTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYELHLSTLGDQSNG
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|