Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 22237..22895 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107591 | ||
Organism | Acinetobacter baumannii strain 1326569 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OIO44_RS19830 | Protein ID | WP_000312250.1 |
Coordinates | 22536..22895 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OIO44_RS19825 | Protein ID | WP_001096429.1 |
Coordinates | 22237..22536 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO44_RS19785 (OIO44_19790) | 17261..18541 | + | 1281 | WP_001093570.1 | hypothetical protein | - |
OIO44_RS19790 (OIO44_19795) | 18646..18903 | + | 258 | WP_000834290.1 | hypothetical protein | - |
OIO44_RS19795 (OIO44_19800) | 18908..19480 | + | 573 | WP_000443897.1 | hypothetical protein | - |
OIO44_RS19800 (OIO44_19805) | 19456..19635 | + | 180 | WP_000387630.1 | hypothetical protein | - |
OIO44_RS19805 (OIO44_19810) | 19652..20281 | + | 630 | WP_000701003.1 | hypothetical protein | - |
OIO44_RS19810 (OIO44_19815) | 20321..20539 | + | 219 | WP_001043201.1 | hypothetical protein | - |
OIO44_RS19815 (OIO44_19820) | 20559..21113 | + | 555 | WP_000790084.1 | hypothetical protein | - |
OIO44_RS19820 (OIO44_19825) | 21163..21699 | + | 537 | WP_000731978.1 | hypothetical protein | - |
OIO44_RS19825 (OIO44_19830) | 22237..22536 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
OIO44_RS19830 (OIO44_19835) | 22536..22895 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OIO44_RS19835 (OIO44_19840) | 23096..23662 | + | 567 | WP_000710385.1 | hypothetical protein | - |
OIO44_RS19840 (OIO44_19845) | 23711..23893 | + | 183 | WP_000373385.1 | hypothetical protein | - |
OIO44_RS19845 (OIO44_19850) | 23960..24658 | + | 699 | WP_264208834.1 | hypothetical protein | - |
OIO44_RS19850 (OIO44_19855) | 24797..25180 | + | 384 | WP_000654348.1 | hypothetical protein | - |
OIO44_RS19855 (OIO44_19860) | 25247..26005 | + | 759 | WP_001053127.1 | hypothetical protein | - |
OIO44_RS19860 (OIO44_19865) | 27060..27374 | + | 315 | WP_000708714.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..67019 | 67019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T261777 WP_000312250.1 NZ_CP107591:c22895-22536 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|