Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 22237..22895 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107588 | ||
| Organism | Acinetobacter baumannii strain 1326527-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OIO39_RS19800 | Protein ID | WP_000312250.1 |
| Coordinates | 22536..22895 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OIO39_RS19795 | Protein ID | WP_001096429.1 |
| Coordinates | 22237..22536 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO39_RS19755 (OIO39_19750) | 17261..18541 | + | 1281 | WP_001093570.1 | hypothetical protein | - |
| OIO39_RS19760 (OIO39_19755) | 18646..18903 | + | 258 | WP_000834290.1 | hypothetical protein | - |
| OIO39_RS19765 (OIO39_19760) | 18908..19480 | + | 573 | WP_000443897.1 | hypothetical protein | - |
| OIO39_RS19770 (OIO39_19765) | 19456..19635 | + | 180 | WP_000387630.1 | hypothetical protein | - |
| OIO39_RS19775 (OIO39_19770) | 19652..20281 | + | 630 | WP_000701003.1 | hypothetical protein | - |
| OIO39_RS19780 (OIO39_19775) | 20321..20539 | + | 219 | WP_001043201.1 | hypothetical protein | - |
| OIO39_RS19785 (OIO39_19780) | 20559..21113 | + | 555 | WP_000790084.1 | hypothetical protein | - |
| OIO39_RS19790 (OIO39_19785) | 21163..21699 | + | 537 | WP_000731978.1 | hypothetical protein | - |
| OIO39_RS19795 (OIO39_19790) | 22237..22536 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| OIO39_RS19800 (OIO39_19795) | 22536..22895 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OIO39_RS19805 (OIO39_19800) | 23096..23662 | + | 567 | WP_000710385.1 | hypothetical protein | - |
| OIO39_RS19810 (OIO39_19805) | 23711..23893 | + | 183 | WP_000373385.1 | hypothetical protein | - |
| OIO39_RS19815 (OIO39_19810) | 23960..24658 | + | 699 | WP_264208834.1 | hypothetical protein | - |
| OIO39_RS19820 (OIO39_19815) | 24797..25180 | + | 384 | WP_000654348.1 | hypothetical protein | - |
| OIO39_RS19825 (OIO39_19820) | 25247..26005 | + | 759 | WP_001053127.1 | hypothetical protein | - |
| OIO39_RS19830 (OIO39_19825) | 27060..27374 | + | 315 | WP_000708714.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..67019 | 67019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T261773 WP_000312250.1 NZ_CP107588:c22895-22536 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|