Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 573448..574102 | Replicon | plasmid pJL.02bL |
Accession | NZ_CP107574 | ||
Organism | Pantoea dispersa strain JL.02bL |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OF384_RS22120 | Protein ID | WP_058770321.1 |
Coordinates | 573448..573819 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A246NDM6 |
Locus tag | OF384_RS22125 | Protein ID | WP_021508926.1 |
Coordinates | 573803..574102 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF384_RS22100 (OF384_22100) | 568724..570103 | + | 1380 | WP_264251845.1 | heavy metal sensor histidine kinase | - |
OF384_RS22105 (OF384_22105) | 570141..570794 | - | 654 | WP_021508932.1 | oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB | - |
OF384_RS22110 (OF384_22110) | 570899..571900 | - | 1002 | WP_264251846.1 | zinc-binding alcohol dehydrogenase family protein | - |
OF384_RS22115 (OF384_22115) | 572037..572954 | + | 918 | WP_058759023.1 | LysR family transcriptional regulator | - |
OF384_RS22120 (OF384_22120) | 573448..573819 | + | 372 | WP_058770321.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OF384_RS22125 (OF384_22125) | 573803..574102 | + | 300 | WP_021508926.1 | XRE family transcriptional regulator | Antitoxin |
OF384_RS22130 (OF384_22130) | 574180..574647 | - | 468 | WP_058759022.1 | hypothetical protein | - |
OF384_RS22135 (OF384_22135) | 574833..575762 | - | 930 | WP_264251847.1 | ABC transporter substrate-binding protein | - |
OF384_RS22140 (OF384_22140) | 575772..576506 | - | 735 | WP_264251848.1 | ABC transporter permease | - |
OF384_RS22145 (OF384_22145) | 576490..577206 | - | 717 | WP_215788040.1 | ABC transporter ATP-binding protein | - |
OF384_RS22150 (OF384_22150) | 577203..578171 | - | 969 | WP_264251849.1 | HesA/MoeB/ThiF family protein | - |
OF384_RS22155 (OF384_22155) | 578182..578940 | - | 759 | WP_058776079.1 | thiazole synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..696693 | 696693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14357.53 Da Isoelectric Point: 10.3096
>T261754 WP_058770321.1 NZ_CP107574:573448-573819 [Pantoea dispersa]
VWQVEATDRFWKWLQAQDEALRLDVLAALKLLAQDGPHLGRPFVDTLMLSRVPNMKELRVQSKGRPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLRIAETEYHHHLNAIGETHNENLG
VWQVEATDRFWKWLQAQDEALRLDVLAALKLLAQDGPHLGRPFVDTLMLSRVPNMKELRVQSKGRPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLRIAETEYHHHLNAIGETHNENLG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|