Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
Location | 253137..253788 | Replicon | plasmid pJL.02bL |
Accession | NZ_CP107574 | ||
Organism | Pantoea dispersa strain JL.02bL |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OF384_RS20685 | Protein ID | WP_264251987.1 |
Coordinates | 253137..253481 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8E1S3S0 |
Locus tag | OF384_RS20690 | Protein ID | WP_058758775.1 |
Coordinates | 253474..253788 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF384_RS20680 (OF384_20680) | 249357..253034 | + | 3678 | WP_264251986.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
OF384_RS20685 (OF384_20685) | 253137..253481 | + | 345 | WP_264251987.1 | toxin | Toxin |
OF384_RS20690 (OF384_20690) | 253474..253788 | + | 315 | WP_058758775.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
OF384_RS20695 (OF384_20695) | 253917..254342 | + | 426 | WP_058781446.1 | DCC1-like thiol-disulfide oxidoreductase family protein | - |
OF384_RS20700 (OF384_20700) | 254339..254767 | - | 429 | WP_058781447.1 | arsenate reductase (glutaredoxin) | - |
OF384_RS20705 (OF384_20705) | 254785..256068 | - | 1284 | WP_264251988.1 | arsenic transporter | - |
OF384_RS20710 (OF384_20710) | 256138..256491 | - | 354 | WP_264251989.1 | metalloregulator ArsR/SmtB family transcription factor | - |
OF384_RS20715 (OF384_20715) | 256840..258135 | + | 1296 | WP_021509465.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..696693 | 696693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13449.24 Da Isoelectric Point: 9.6738
>T261752 WP_264251987.1 NZ_CP107574:253137-253481 [Pantoea dispersa]
MQATFIELSSFQKYRADYLSDDQFRLFQNMLLADPEKGDVIPDTGGLRKVRFRDERRNKGARGGIRIIYYWTNEKGQFIL
FSIYDKDQRDDLTKQQRDALAEALNVIKKGLRHD
MQATFIELSSFQKYRADYLSDDQFRLFQNMLLADPEKGDVIPDTGGLRKVRFRDERRNKGARGGIRIIYYWTNEKGQFIL
FSIYDKDQRDDLTKQQRDALAEALNVIKKGLRHD
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|