Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 178300..178980 | Replicon | chromosome |
Accession | NZ_CP107573 | ||
Organism | Pantoea dispersa strain JL.02bL |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OF384_RS00815 | Protein ID | WP_264250233.1 |
Coordinates | 178300..178599 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A246NHX0 |
Locus tag | OF384_RS00820 | Protein ID | WP_058775157.1 |
Coordinates | 178648..178980 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF384_RS00800 (OF384_00800) | 174704..175198 | + | 495 | WP_021507883.1 | GNAT family N-acetyltransferase | - |
OF384_RS00805 (OF384_00805) | 175496..176410 | - | 915 | WP_021507882.1 | sugar ABC transporter substrate-binding protein | - |
OF384_RS00810 (OF384_00810) | 176846..178240 | + | 1395 | WP_058775155.1 | MFS transporter | - |
OF384_RS00815 (OF384_00815) | 178300..178599 | + | 300 | WP_264250233.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OF384_RS00820 (OF384_00820) | 178648..178980 | + | 333 | WP_058775157.1 | HigA family addiction module antitoxin | Antitoxin |
OF384_RS00825 (OF384_00825) | 179072..180235 | + | 1164 | WP_021507880.1 | HD-GYP domain-containing protein | - |
OF384_RS00830 (OF384_00830) | 180344..180433 | + | 90 | WP_021507879.1 | K(+)-transporting ATPase subunit F | - |
OF384_RS00835 (OF384_00835) | 180433..182112 | + | 1680 | WP_264250237.1 | potassium-transporting ATPase subunit KdpA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11530.28 Da Isoelectric Point: 10.6015
>T261744 WP_264250233.1 NZ_CP107573:178300-178599 [Pantoea dispersa]
MGSIRAFRQAWLAQFYTHGKPHAQIPRAIESALARKLDIIHAATSHQDLRSPPGNRFEALKPPLLGYYSIRVNAQYRLIF
QWAKGEAWDLYLDPHRYKK
MGSIRAFRQAWLAQFYTHGKPHAQIPRAIESALARKLDIIHAATSHQDLRSPPGNRFEALKPPLLGYYSIRVNAQYRLIF
QWAKGEAWDLYLDPHRYKK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|