Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1507776..1508370 | Replicon | chromosome |
Accession | NZ_CP107548 | ||
Organism | Pusillimonas sp. M17 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | OEG81_RS07255 | Protein ID | WP_264132053.1 |
Coordinates | 1508092..1508370 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OEG81_RS07250 | Protein ID | WP_264132052.1 |
Coordinates | 1507776..1508078 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG81_RS07230 (OEG81_07230) | 1503006..1505348 | - | 2343 | WP_264132047.1 | ATP-dependent DNA helicase | - |
OEG81_RS07235 (OEG81_07235) | 1505345..1507045 | - | 1701 | WP_264132048.1 | VRR-NUC domain-containing protein | - |
OEG81_RS07240 (OEG81_07240) | 1507269..1507469 | + | 201 | WP_264132050.1 | CsbD family protein | - |
OEG81_RS07245 (OEG81_07245) | 1507529..1507693 | + | 165 | WP_264132051.1 | DUF1328 domain-containing protein | - |
OEG81_RS07250 (OEG81_07250) | 1507776..1508078 | - | 303 | WP_264132052.1 | HigA family addiction module antitoxin | Antitoxin |
OEG81_RS07255 (OEG81_07255) | 1508092..1508370 | - | 279 | WP_264132053.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEG81_RS07260 (OEG81_07260) | 1508542..1509030 | + | 489 | WP_264132054.1 | flagellar protein FlhE | - |
OEG81_RS07265 (OEG81_07265) | 1509183..1509890 | - | 708 | WP_264132518.1 | haloacid dehalogenase type II | - |
OEG81_RS07270 (OEG81_07270) | 1509958..1511400 | - | 1443 | WP_264132055.1 | sodium:solute symporter family protein | - |
OEG81_RS07275 (OEG81_07275) | 1511887..1512669 | + | 783 | WP_264132056.1 | 3-oxoacyl-ACP reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10566.21 Da Isoelectric Point: 9.3251
>T261726 WP_264132053.1 NZ_CP107548:c1508370-1508092 [Pusillimonas sp. M17]
MIKSFRCADTQALFEGRHVARLANIKSIAERKLQMLDSANTLIFLRSPPGNRLEALKGNRIGQHSIRINDQWRICFVWTM
EGPDGVEIVDYH
MIKSFRCADTQALFEGRHVARLANIKSIAERKLQMLDSANTLIFLRSPPGNRLEALKGNRIGQHSIRINDQWRICFVWTM
EGPDGVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|