Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 327803..328389 Replicon chromosome
Accession NZ_CP107508
Organism Klebsiella pneumoniae strain CRKP_3

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OH510_RS01525 Protein ID WP_002920800.1
Coordinates 328021..328389 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag OH510_RS01520 Protein ID WP_002920802.1
Coordinates 327803..328024 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH510_RS01500 323960..324886 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OH510_RS01505 324883..326160 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
OH510_RS01510 326157..326924 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OH510_RS01515 326926..327639 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OH510_RS01520 327803..328024 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OH510_RS01525 328021..328389 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OH510_RS01530 328662..329978 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OH510_RS01535 330085..330972 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OH510_RS01540 330969..331814 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OH510_RS01545 331816..332886 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 324883..333623 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T261637 WP_002920800.1 NZ_CP107508:328021-328389 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT261637 WP_002920802.1 NZ_CP107508:327803-328024 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References