261540

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3059554..3060140 Replicon chromosome
Accession NZ_CP107488
Organism Klebsiella pneumoniae strain CRKP_7

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OH500_RS14930 Protein ID WP_002920800.1
Coordinates 3059772..3060140 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag OH500_RS14925 Protein ID WP_002920802.1
Coordinates 3059554..3059775 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH500_RS14905 3055711..3056637 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OH500_RS14910 3056634..3057911 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
OH500_RS14915 3057908..3058675 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OH500_RS14920 3058677..3059390 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OH500_RS14925 3059554..3059775 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OH500_RS14930 3059772..3060140 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OH500_RS14935 3060413..3061729 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OH500_RS14940 3061836..3062723 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OH500_RS14945 3062720..3063565 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OH500_RS14950 3063567..3064637 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3056634..3065374 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T261540 WP_002920800.1 NZ_CP107488:3059772-3060140 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT261540 WP_002920802.1 NZ_CP107488:3059554-3059775 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References