Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 36502..36928 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107475 | ||
Organism | Klebsiella pneumoniae strain CRKP_10 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OH522_RS28305 | Protein ID | WP_001372321.1 |
Coordinates | 36502..36627 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 36704..36928 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH522_RS28270 (31557) | 31557..31784 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
OH522_RS28275 (31878) | 31878..32564 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
OH522_RS28280 (32755) | 32755..33138 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OH522_RS28285 (33415) | 33415..34062 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OH522_RS28290 (34359) | 34359..35180 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OH522_RS28295 (35291) | 35291..35587 | - | 297 | WP_001272251.1 | hypothetical protein | - |
OH522_RS28300 (35887) | 35887..36183 | + | 297 | Protein_40 | hypothetical protein | - |
OH522_RS28305 (36502) | 36502..36627 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OH522_RS28310 (36569) | 36569..36718 | - | 150 | Protein_42 | plasmid maintenance protein Mok | - |
- (36704) | 36704..36928 | - | 225 | NuclAT_0 | - | Antitoxin |
- (36704) | 36704..36928 | - | 225 | NuclAT_0 | - | Antitoxin |
- (36704) | 36704..36928 | - | 225 | NuclAT_0 | - | Antitoxin |
- (36704) | 36704..36928 | - | 225 | NuclAT_0 | - | Antitoxin |
OH522_RS28315 (36940) | 36940..37659 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
OH522_RS28320 (37656) | 37656..38090 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OH522_RS28325 (38159) | 38159..40182 | - | 2024 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
OH522_RS28330 (40243) | 40243..40476 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
OH522_RS28335 (40534) | 40534..41061 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OH522_RS28340 (41363) | 41363..41830 | + | 468 | Protein_48 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..154725 | 154725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261472 WP_001372321.1 NZ_CP107475:c36627-36502 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT261472 NZ_CP107475:c36928-36704 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|