Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 65442..65695 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107464 | ||
| Organism | Klebsiella pneumoniae strain CRKP_12 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH534_RS27330 | Protein ID | WP_001312851.1 |
| Coordinates | 65442..65591 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 65636..65695 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH534_RS27295 (60801) | 60801..61216 | - | 416 | Protein_83 | IS1-like element IS1B family transposase | - |
| OH534_RS27300 (61465) | 61465..61866 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH534_RS27305 (61799) | 61799..62056 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH534_RS27310 (62149) | 62149..62802 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH534_RS27315 (63741) | 63741..64598 | - | 858 | WP_142295464.1 | incFII family plasmid replication initiator RepA | - |
| OH534_RS27320 (64591) | 64591..64665 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH534_RS27325 (64910) | 64910..65158 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH534_RS27330 (65442) | 65442..65591 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (65636) | 65636..65695 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (65636) | 65636..65695 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (65636) | 65636..65695 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (65636) | 65636..65695 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH534_RS27335 (65896) | 65896..66228 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH534_RS27340 (66290) | 66290..66889 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH534_RS27345 (67275) | 67275..67475 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH534_RS27350 (67607) | 67607..68167 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH534_RS27355 (68222) | 68222..68968 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH534_RS27360 (68988) | 68988..69188 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH534_RS27365 (69213) | 69213..69917 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH534_RS27370 (69970) | 69970..70035 | + | 66 | Protein_98 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB | - | 1..128751 | 128751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261423 WP_001312851.1 NZ_CP107464:c65591-65442 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261423 NZ_CP107464:65636-65695 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
