Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 51939..52208 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107464 | ||
| Organism | Klebsiella pneumoniae strain CRKP_12 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH534_RS27220 | Protein ID | WP_001372321.1 |
| Coordinates | 52083..52208 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 51939..52004 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH534_RS27190 | 47649..48176 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH534_RS27195 | 48234..48467 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH534_RS27200 | 48528..50551 | + | 2024 | Protein_64 | ParB/RepB/Spo0J family partition protein | - |
| OH534_RS27205 | 50620..51054 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH534_RS27210 | 51051..51770 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 51782..52006 | + | 225 | NuclAT_0 | - | - |
| - | 51782..52006 | + | 225 | NuclAT_0 | - | - |
| - | 51782..52006 | + | 225 | NuclAT_0 | - | - |
| - | 51782..52006 | + | 225 | NuclAT_0 | - | - |
| - | 51939..52004 | - | 66 | - | - | Antitoxin |
| OH534_RS27215 | 51992..52141 | + | 150 | Protein_67 | plasmid maintenance protein Mok | - |
| OH534_RS27220 | 52083..52208 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH534_RS27225 | 52527..52823 | - | 297 | Protein_69 | hypothetical protein | - |
| OH534_RS27230 | 53123..53419 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| OH534_RS27235 | 53530..54351 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OH534_RS27240 | 54648..55295 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH534_RS27245 | 55572..55955 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH534_RS27250 | 56146..56832 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| OH534_RS27255 | 56926..57153 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB | - | 1..128751 | 128751 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261421 WP_001372321.1 NZ_CP107464:52083-52208 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT261421 NZ_CP107464:c52004-51939 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|