Detailed information of TA system TA261420

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 51782..52208
• Replicon: plasmid unnamed1
• Accession: NZ_CP107464
• Organism: Klebsiella pneumoniae strain CRKP_12

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH534_RS27220
• Protein ID: WP_001372321.1
• Coordinates: 52083..52208 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	51782..52006 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH534_RS27185 (46892)	46892..47347	-	456	Protein_61	hypothetical protein	-
OH534_RS27190 (47649)	47649..48176	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH534_RS27195 (48234)	48234..48467	+	234	WP_000006003.1	DUF905 family protein	-
OH534_RS27200 (48528)	48528..50551	+	2024	Protein_64	ParB/RepB/Spo0J family partition protein	-
OH534_RS27205 (50620)	50620..51054	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH534_RS27210 (51051)	51051..51770	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
- (51782)	51782..52006	+	225	NuclAT_0	-	Antitoxin
- (51782)	51782..52006	+	225	NuclAT_0	-	Antitoxin
- (51782)	51782..52006	+	225	NuclAT_0	-	Antitoxin
- (51782)	51782..52006	+	225	NuclAT_0	-	Antitoxin
OH534_RS27215 (51992)	51992..52141	+	150	Protein_67	plasmid maintenance protein Mok	-
OH534_RS27220 (52083)	52083..52208	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH534_RS27225 (52527)	52527..52823	-	297	Protein_69	hypothetical protein	-
OH534_RS27230 (53123)	53123..53419	+	297	WP_001272251.1	hypothetical protein	-
OH534_RS27235 (53530)	53530..54351	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OH534_RS27240 (54648)	54648..55295	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OH534_RS27245 (55572)	55572..55955	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OH534_RS27250 (56146)	56146..56832	+	687	WP_015059009.1	PAS domain-containing protein	-
OH534_RS27255 (56926)	56926..57153	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / blaSHV-12 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB	-	1..128751	128751

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T261420 WP_001372321.1 NZ_CP107464:52083-52208 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT261420 NZ_CP107464:51782-52006 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin