Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48422..48675 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107454 | ||
| Organism | Klebsiella pneumoniae strain CRKP_14 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH499_RS28380 | Protein ID | WP_001312851.1 |
| Coordinates | 48422..48571 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48616..48675 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH499_RS28345 (43781) | 43781..44196 | - | 416 | Protein_63 | IS1-like element IS1B family transposase | - |
| OH499_RS28350 (44445) | 44445..44846 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH499_RS28355 (44779) | 44779..45036 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH499_RS28360 (45129) | 45129..45782 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH499_RS28365 (46721) | 46721..47578 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH499_RS28370 (47571) | 47571..47645 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH499_RS28375 (47890) | 47890..48138 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH499_RS28380 (48422) | 48422..48571 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (48616) | 48616..48675 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (48616) | 48616..48675 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (48616) | 48616..48675 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (48616) | 48616..48675 | + | 60 | NuclAT_0 | - | Antitoxin |
| OH499_RS28385 (48876) | 48876..49208 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH499_RS28390 (49270) | 49270..49869 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH499_RS28395 (50255) | 50255..50455 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH499_RS28400 (50587) | 50587..51147 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH499_RS28405 (51202) | 51202..51948 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH499_RS28410 (51968) | 51968..52168 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH499_RS28415 (52193) | 52193..52897 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH499_RS28420 (52950) | 52950..53015 | + | 66 | Protein_78 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 / catA2 / blaCTX-M-65 | - | 1..96034 | 96034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261375 WP_001312851.1 NZ_CP107454:c48571-48422 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261375 NZ_CP107454:48616-48675 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|