Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3490286..3491061 | Replicon | chromosome |
Accession | NZ_CP107452 | ||
Organism | Klebsiella pneumoniae strain CRKP_14 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | OH499_RS17230 | Protein ID | WP_004150910.1 |
Coordinates | 3490576..3491061 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | OH499_RS17225 | Protein ID | WP_004150912.1 |
Coordinates | 3490286..3490579 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH499_RS17205 | 3485494..3486096 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
OH499_RS17210 | 3486194..3487105 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
OH499_RS17215 | 3487106..3488254 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
OH499_RS17220 | 3488265..3489641 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
OH499_RS17225 | 3490286..3490579 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
OH499_RS17230 | 3490576..3491061 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
OH499_RS17235 | 3491765..3492358 | + | 594 | WP_004188553.1 | hypothetical protein | - |
OH499_RS17240 | 3492455..3492671 | + | 217 | Protein_3368 | transposase | - |
OH499_RS17245 | 3493277..3494149 | + | 873 | WP_004188557.1 | ParA family protein | - |
OH499_RS17250 | 3494149..3494532 | + | 384 | WP_004150906.1 | hypothetical protein | - |
OH499_RS17255 | 3494525..3495892 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3492455..3492607 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T261368 WP_004150910.1 NZ_CP107452:3490576-3491061 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |