Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78249..78502 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107443 | ||
| Organism | Klebsiella pneumoniae strain CRKP_16 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH519_RS28590 | Protein ID | WP_001312851.1 |
| Coordinates | 78249..78398 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 78443..78502 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH519_RS28555 (73608) | 73608..74023 | - | 416 | Protein_90 | IS1-like element IS1B family transposase | - |
| OH519_RS28560 (74272) | 74272..74673 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH519_RS28565 (74606) | 74606..74863 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH519_RS28570 (74956) | 74956..75609 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH519_RS28575 (76548) | 76548..77405 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH519_RS28580 (77398) | 77398..77472 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH519_RS28585 (77717) | 77717..77965 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH519_RS28590 (78249) | 78249..78398 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (78443) | 78443..78502 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78443) | 78443..78502 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78443) | 78443..78502 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (78443) | 78443..78502 | + | 60 | NuclAT_1 | - | Antitoxin |
| OH519_RS28595 (78703) | 78703..79035 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH519_RS28600 (79097) | 79097..79696 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH519_RS28605 (80082) | 80082..80282 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH519_RS28610 (80414) | 80414..80974 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH519_RS28615 (81029) | 81029..81775 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH519_RS28620 (81795) | 81795..81995 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH519_RS28625 (82020) | 82020..82724 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH519_RS28630 (82777) | 82777..82842 | + | 66 | Protein_105 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..154725 | 154725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261327 WP_001312851.1 NZ_CP107443:c78398-78249 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261327 NZ_CP107443:78443-78502 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
