Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 58276..58529 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107434 | ||
| Organism | Klebsiella pneumoniae strain CRKP_18 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH509_RS28465 | Protein ID | WP_001312851.1 |
| Coordinates | 58380..58529 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 58276..58335 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH509_RS28440 (55003) | 55003..55749 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH509_RS28445 (55804) | 55804..56364 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH509_RS28450 (56496) | 56496..56696 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OH509_RS28455 (57082) | 57082..57681 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH509_RS28460 (57743) | 57743..58075 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (58276) | 58276..58335 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (58276) | 58276..58335 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (58276) | 58276..58335 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (58276) | 58276..58335 | - | 60 | NuclAT_1 | - | Antitoxin |
| OH509_RS28465 (58380) | 58380..58529 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OH509_RS28470 (58813) | 58813..59061 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH509_RS28475 (59306) | 59306..59380 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH509_RS28480 (59373) | 59373..60230 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH509_RS28485 (61169) | 61169..61822 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH509_RS28490 (61915) | 61915..62172 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH509_RS28495 (62105) | 62105..62506 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH509_RS28500 (62755) | 62755..63170 | + | 416 | Protein_79 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aph(3')-IIa / rmtB / blaTEM-1B | - | 1..118453 | 118453 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261276 WP_001312851.1 NZ_CP107434:58380-58529 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261276 NZ_CP107434:c58335-58276 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
