Detailed information of TA system TA261274

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 18807..19076
• Replicon: plasmid unnamed2
• Accession: NZ_CP107434
• Organism: Klebsiella pneumoniae strain CRKP_18

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH509_RS28235
• Protein ID: WP_001372321.1
• Coordinates: 18951..19076 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	18807..18872 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH509_RS28205	14517..15044	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH509_RS28210	15102..15335	+	234	WP_000006003.1	DUF905 family protein	-
OH509_RS28215	15396..17419	+	2024	Protein_22	ParB/RepB/Spo0J family partition protein	-
OH509_RS28220	17488..17922	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH509_RS28225	17919..18638	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	18650..18874	+	225	NuclAT_0	-	-
-	18650..18874	+	225	NuclAT_0	-	-
-	18650..18874	+	225	NuclAT_0	-	-
-	18650..18874	+	225	NuclAT_0	-	-
-	18807..18872	-	66	-	-	Antitoxin
OH509_RS28230	18860..19009	+	150	Protein_25	plasmid maintenance protein Mok	-
OH509_RS28235	18951..19076	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH509_RS28240	19395..19691	-	297	Protein_27	hypothetical protein	-
OH509_RS28245	19991..20287	+	297	WP_001272251.1	hypothetical protein	-
OH509_RS28250	20398..21219	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OH509_RS28255	21516..22163	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OH509_RS28260	22440..22823	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OH509_RS28265	23014..23700	+	687	WP_015059009.1	PAS domain-containing protein	-
OH509_RS28270	23794..24021	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-55 / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aph(3')-IIa / rmtB / blaTEM-1B	-	1..118453	118453

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T261274 WP_001372321.1 NZ_CP107434:18951-19076 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT261274 NZ_CP107434:c18872-18807 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin