Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 18650..19076 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107434 | ||
| Organism | Klebsiella pneumoniae strain CRKP_18 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OH509_RS28235 | Protein ID | WP_001372321.1 |
| Coordinates | 18951..19076 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 18650..18874 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH509_RS28200 (13760) | 13760..14215 | - | 456 | Protein_19 | hypothetical protein | - |
| OH509_RS28205 (14517) | 14517..15044 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| OH509_RS28210 (15102) | 15102..15335 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| OH509_RS28215 (15396) | 15396..17419 | + | 2024 | Protein_22 | ParB/RepB/Spo0J family partition protein | - |
| OH509_RS28220 (17488) | 17488..17922 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OH509_RS28225 (17919) | 17919..18638 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - (18650) | 18650..18874 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (18650) | 18650..18874 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (18650) | 18650..18874 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (18650) | 18650..18874 | + | 225 | NuclAT_0 | - | Antitoxin |
| OH509_RS28230 (18860) | 18860..19009 | + | 150 | Protein_25 | plasmid maintenance protein Mok | - |
| OH509_RS28235 (18951) | 18951..19076 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OH509_RS28240 (19395) | 19395..19691 | - | 297 | Protein_27 | hypothetical protein | - |
| OH509_RS28245 (19991) | 19991..20287 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| OH509_RS28250 (20398) | 20398..21219 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| OH509_RS28255 (21516) | 21516..22163 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| OH509_RS28260 (22440) | 22440..22823 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OH509_RS28265 (23014) | 23014..23700 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| OH509_RS28270 (23794) | 23794..24021 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 / floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aph(3')-IIa / rmtB / blaTEM-1B | - | 1..118453 | 118453 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261273 WP_001372321.1 NZ_CP107434:18951-19076 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT261273 NZ_CP107434:18650-18874 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|