Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 85905..86158 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107433 | ||
| Organism | Klebsiella pneumoniae strain CRKP_18 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH509_RS27565 | Protein ID | WP_001312851.1 |
| Coordinates | 85905..86054 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 86099..86158 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH509_RS27535 (81928) | 81928..82329 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH509_RS27540 (82262) | 82262..82519 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH509_RS27545 (82612) | 82612..83265 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH509_RS27550 (84204) | 84204..85061 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH509_RS27555 (85054) | 85054..85128 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH509_RS27560 (85373) | 85373..85621 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH509_RS27565 (85905) | 85905..86054 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (86099) | 86099..86158 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (86099) | 86099..86158 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (86099) | 86099..86158 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (86099) | 86099..86158 | + | 60 | NuclAT_0 | - | Antitoxin |
| OH509_RS27570 (86359) | 86359..86691 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OH509_RS27575 (86753) | 86753..87352 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH509_RS27580 (87738) | 87738..87938 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OH509_RS27585 (88070) | 88070..88630 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH509_RS27590 (88685) | 88685..89431 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH509_RS27595 (89451) | 89451..89651 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OH509_RS27600 (89676) | 89676..90380 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH509_RS27605 (90420) | 90420..90686 | + | 267 | WP_233904129.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA2 / blaKPC-2 / dfrA14 | - | 1..169677 | 169677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261268 WP_001312851.1 NZ_CP107433:c86054-85905 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261268 NZ_CP107433:86099-86158 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|