Detailed information of TA system TA261223

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 128514..128783
• Replicon: plasmid unnamed1
• Accession: NZ_CP107423
• Organism: Klebsiella pneumoniae strain CRKP_20

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH530_RS27630
• Protein ID: WP_001372321.1
• Coordinates: 128658..128783 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	128514..128579 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH530_RS27595	123516..123977	-	462	Protein_163	hypothetical protein	-
OH530_RS27600	124279..124806	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH530_RS27605	124864..125097	+	234	WP_000006003.1	DUF905 family protein	-
OH530_RS27610	125158..127126	+	1969	Protein_166	ParB/RepB/Spo0J family partition protein	-
OH530_RS27615	127195..127629	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH530_RS27620	127626..128345	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	128357..128581	+	225	NuclAT_0	-	-
-	128357..128581	+	225	NuclAT_0	-	-
-	128357..128581	+	225	NuclAT_0	-	-
-	128357..128581	+	225	NuclAT_0	-	-
-	128514..128579	-	66	-	-	Antitoxin
OH530_RS27625	128567..128716	+	150	Protein_169	plasmid maintenance protein Mok	-
OH530_RS27630	128658..128783	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH530_RS27635	129102..129398	-	297	Protein_171	hypothetical protein	-
OH530_RS27640	129698..129994	+	297	WP_001272251.1	hypothetical protein	-
OH530_RS27645	130105..130926	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OH530_RS27650	131223..131870	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OH530_RS27655	132147..132530	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OH530_RS27660	132721..133407	+	687	WP_015059009.1	PAS domain-containing protein	-
OH530_RS27665	133501..133728	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB	-	1..159410	159410

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T261223 WP_001372321.1 NZ_CP107423:128658-128783 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT261223 NZ_CP107423:c128579-128514 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin