Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 82098..82351 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107423 | ||
| Organism | Klebsiella pneumoniae strain CRKP_20 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OH530_RS27325 | Protein ID | WP_001312851.1 |
| Coordinates | 82202..82351 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 82098..82157 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH530_RS27285 (77758) | 77758..77823 | - | 66 | Protein_101 | helix-turn-helix domain-containing protein | - |
| OH530_RS27290 (77876) | 77876..78580 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OH530_RS27295 (78605) | 78605..78805 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OH530_RS27300 (78825) | 78825..79571 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OH530_RS27305 (79626) | 79626..80186 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OH530_RS27310 (80318) | 80318..80518 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OH530_RS27315 (80904) | 80904..81503 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OH530_RS27320 (81565) | 81565..81897 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (82098) | 82098..82157 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (82098) | 82098..82157 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (82098) | 82098..82157 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (82098) | 82098..82157 | - | 60 | NuclAT_1 | - | Antitoxin |
| OH530_RS27325 (82202) | 82202..82351 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OH530_RS27330 (82635) | 82635..82883 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OH530_RS27335 (83128) | 83128..83202 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| OH530_RS27340 (83195) | 83195..84052 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OH530_RS27345 (84991) | 84991..85644 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OH530_RS27350 (85737) | 85737..85994 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OH530_RS27355 (85927) | 85927..86328 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OH530_RS27360 (86577) | 86577..86992 | + | 416 | Protein_116 | IS1-like element IS1B family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..159410 | 159410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T261219 WP_001312851.1 NZ_CP107423:82202-82351 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT261219 NZ_CP107423:c82157-82098 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|