Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3072076..3072722 | Replicon | chromosome |
| Accession | NZ_CP107422 | ||
| Organism | Klebsiella pneumoniae strain CRKP_20 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W8UNE1 |
| Locus tag | OH530_RS14985 | Protein ID | WP_002920560.1 |
| Coordinates | 3072076..3072423 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | OH530_RS14990 | Protein ID | WP_002920557.1 |
| Coordinates | 3072423..3072722 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH530_RS14975 | 3068002..3069435 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| OH530_RS14980 | 3069453..3071900 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| OH530_RS14985 | 3072076..3072423 | + | 348 | WP_002920560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OH530_RS14990 | 3072423..3072722 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OH530_RS14995 | 3072785..3074293 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| OH530_RS15000 | 3074498..3074827 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| OH530_RS15005 | 3074878..3075708 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| OH530_RS15010 | 3075758..3076516 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13502.56 Da Isoelectric Point: 6.2300
>T261212 WP_002920560.1 NZ_CP107422:3072076-3072423 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBF8 |