Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1827297..1827477 | Replicon | chromosome |
| Accession | NC_016941 | ||
| Organism | Staphylococcus aureus subsp. aureus MSHR1132 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAMSHR1132_RS14115 | Protein ID | WP_001801861.1 |
| Coordinates | 1827297..1827392 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1827420..1827477 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAMSHR1132_RS08590 | 1822476..1823102 | + | 627 | WP_000669020.1 | hypothetical protein | - |
| SAMSHR1132_RS08595 | 1823143..1823484 | + | 342 | WP_000627553.1 | DUF3969 family protein | - |
| SAMSHR1132_RS08600 | 1823585..1824157 | + | 573 | WP_000414227.1 | hypothetical protein | - |
| SAMSHR1132_RS08605 | 1824355..1824912 | - | 558 | WP_000864134.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SAMSHR1132_RS08610 | 1825096..1825281 | - | 186 | WP_000809859.1 | hypothetical protein | - |
| SAMSHR1132_RS08615 | 1825283..1825459 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SAMSHR1132_RS08620 | 1825470..1825853 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SAMSHR1132_RS14115 | 1827297..1827392 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1827420..1827477 | - | 58 | - | - | Antitoxin |
| SAMSHR1132_RS08630 | 1827515..1827616 | + | 102 | WP_042355399.1 | hypothetical protein | - |
| SAMSHR1132_RS08635 | 1827751..1828203 | - | 453 | WP_000428250.1 | DUF1433 domain-containing protein | - |
| SAMSHR1132_RS08640 | 1828241..1829851 | + | 1611 | WP_001026719.1 | hypothetical protein | - |
| SAMSHR1132_RS08645 | 1829866..1830165 | + | 300 | WP_000095394.1 | WXG100 family type VII secretion target | - |
| SAMSHR1132_RS08650 | 1830292..1831557 | - | 1266 | WP_000072359.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26120 WP_001801861.1 NC_016941:1827297-1827392 [Staphylococcus argenteus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26120 NC_016941:1827297-1827392 [Staphylococcus argenteus]
GTGATGCTTATTTTCGTTCACATCATAGCGCCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCGCCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT26120 NC_016941:c1827477-1827420 [Staphylococcus argenteus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|