Detailed information of TA system TA261198

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 122430..122699
• Replicon: plasmid unnamed1
• Accession: NZ_CP107418
• Organism: Klebsiella pneumoniae strain CRKP_21

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OH498_RS27795
• Protein ID: WP_001372321.1
• Coordinates: 122574..122699 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	122430..122495 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OH498_RS27765	118140..118667	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OH498_RS27770	118725..118958	+	234	WP_000006003.1	DUF905 family protein	-
OH498_RS27775	119019..121042	+	2024	Protein_164	ParB/RepB/Spo0J family partition protein	-
OH498_RS27780	121111..121545	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OH498_RS27785	121542..122261	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	122273..122497	+	225	NuclAT_0	-	-
-	122273..122497	+	225	NuclAT_0	-	-
-	122273..122497	+	225	NuclAT_0	-	-
-	122273..122497	+	225	NuclAT_0	-	-
-	122430..122495	-	66	-	-	Antitoxin
OH498_RS27790	122483..122632	+	150	Protein_167	plasmid maintenance protein Mok	-
OH498_RS27795	122574..122699	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OH498_RS27800	123018..123314	-	297	Protein_169	hypothetical protein	-
OH498_RS27805	123614..123910	+	297	WP_001272251.1	hypothetical protein	-
OH498_RS27810	124021..124842	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OH498_RS27815	125139..125786	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OH498_RS27820	126063..126446	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OH498_RS27825	126637..127323	+	687	WP_015059009.1	PAS domain-containing protein	-
OH498_RS27830	127417..127644	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB	-	1..210034	210034

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T261198 WP_001372321.1 NZ_CP107418:122574-122699 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT261198 NZ_CP107418:c122495-122430 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin