Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 122273..122699 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107418 | ||
Organism | Klebsiella pneumoniae strain CRKP_21 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OH498_RS27795 | Protein ID | WP_001372321.1 |
Coordinates | 122574..122699 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 122273..122497 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH498_RS27760 (117371) | 117371..117838 | - | 468 | Protein_161 | hypothetical protein | - |
OH498_RS27765 (118140) | 118140..118667 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OH498_RS27770 (118725) | 118725..118958 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
OH498_RS27775 (119019) | 119019..121042 | + | 2024 | Protein_164 | ParB/RepB/Spo0J family partition protein | - |
OH498_RS27780 (121111) | 121111..121545 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OH498_RS27785 (121542) | 121542..122261 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- (122273) | 122273..122497 | + | 225 | NuclAT_0 | - | Antitoxin |
- (122273) | 122273..122497 | + | 225 | NuclAT_0 | - | Antitoxin |
- (122273) | 122273..122497 | + | 225 | NuclAT_0 | - | Antitoxin |
- (122273) | 122273..122497 | + | 225 | NuclAT_0 | - | Antitoxin |
OH498_RS27790 (122483) | 122483..122632 | + | 150 | Protein_167 | plasmid maintenance protein Mok | - |
OH498_RS27795 (122574) | 122574..122699 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OH498_RS27800 (123018) | 123018..123314 | - | 297 | Protein_169 | hypothetical protein | - |
OH498_RS27805 (123614) | 123614..123910 | + | 297 | WP_001272251.1 | hypothetical protein | - |
OH498_RS27810 (124021) | 124021..124842 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OH498_RS27815 (125139) | 125139..125786 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OH498_RS27820 (126063) | 126063..126446 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OH498_RS27825 (126637) | 126637..127323 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
OH498_RS27830 (127417) | 127417..127644 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB | - | 1..210034 | 210034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T261197 WP_001372321.1 NZ_CP107418:122574-122699 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT261197 NZ_CP107418:122273-122497 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|